![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) ![]() |
![]() | Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins) coupled with a NADP-binding domain of alpha/beta class |
![]() | Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (9 species) |
![]() | Species Spinach (Spinacia oleracea) [TaxId:3562] [50416] (7 PDB entries) |
![]() | Domain d1fnca1: 1fnc A:19-154 [25627] Other proteins in same PDB: d1fnca2 complexed with a2p, fda, so4 |
PDB Entry: 1fnc (more details), 2 Å
SCOPe Domain Sequences for d1fnca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fnca1 b.43.4.2 (A:19-154) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Spinach (Spinacia oleracea) [TaxId: 3562]} hskkmeegitvnkfkpktpyvgrcllntkitgddapgetwhmvfshegeipyregqsvgv ipdgedkngkphklrlysiassalgdfgdaksvslcvkrliytndagetikgvcsnflcd lkpgaevkltgpvgke
Timeline for d1fnca1: