SCOP 1.67: Domain d1fnd_1: 1fnd 19-154

Lineage for d1fnd_1 (1fnd 19-154)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (8 proteins)
   coupled with a NADP-binding domain of alpha/beta class

6. Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [50416] (7 PDB entries)

8. Domain d1fnd_1: 1fnd 19-154 [25626]
   Other proteins in same PDB: d1fnd_2
   complexed with a2p, fad, so4

Details for d1fnd_1

PDB Entry: 1fnd, 1.7 Å

PDB Description: refined crystal structure of spinach ferredoxin reductase at 1.7 angstroms resolution: oxidized, reduced, and 2'-phospho-5'-amp bound states

SCOP Domain Sequences for d1fnd_1:

Sequence; same for both SEQRES and ATOM records:

>d1fnd_1 b.43.4.2 (19-154) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Spinach (Spinacia oleracea)}
hskkmeegitvnkfkpktpyvgrcllntkitgddapgetwhmvfshegeipyregqsvgv
ipdgedkngkphklrlysiassalgdfgdaksvslcvkrliytndagetikgvcsnflcd
lkpgaevkltgpvgke

Timeline for d1fnd_1:

• d1fnd_1 first appeared (with stable ids) in SCOP 1.55
  
• d1fnd_1 appears in SCOP 1.65
  
• d1fnd_1 appears in SCOP 1.69
  
• d1fnd_1 appears in the current release, SCOPe 2.08, called d1fnda1