Class b: All beta proteins [48724] (141 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) |
Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (8 proteins) coupled with a NADP-binding domain of alpha/beta class |
Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species) |
Species Spinach (Spinacia oleracea) [TaxId:3562] [50416] (7 PDB entries) |
Domain d1fnd_1: 1fnd 19-154 [25626] Other proteins in same PDB: d1fnd_2 complexed with a2p, fad, so4 |
PDB Entry: 1fnd (more details), 1.7 Å
SCOP Domain Sequences for d1fnd_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fnd_1 b.43.4.2 (19-154) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Spinach (Spinacia oleracea)} hskkmeegitvnkfkpktpyvgrcllntkitgddapgetwhmvfshegeipyregqsvgv ipdgedkngkphklrlysiassalgdfgdaksvslcvkrliytndagetikgvcsnflcd lkpgaevkltgpvgke
Timeline for d1fnd_1: