Lineage for d1dfca3 (1dfc A:1260-1382)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1790651Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1791539Superfamily b.42.5: Actin-crosslinking proteins [50405] (3 families) (S)
  5. 1791540Family b.42.5.1: Fascin [50406] (1 protein)
    automatically mapped to Pfam PF06268
  6. 1791541Protein Fascin [50407] (1 species)
    duplication: tandem repeat of four domains
  7. 1791542Species Human (Homo sapiens) [TaxId:9606] [50408] (6 PDB entries)
  8. 1791585Domain d1dfca3: 1dfc A:1260-1382 [25618]

Details for d1dfca3

PDB Entry: 1dfc (more details), 2.9 Å

PDB Description: crystal structure of human fascin, an actin-crosslinking protein
PDB Compounds: (A:) fascin

SCOPe Domain Sequences for d1dfca3:

Sequence, based on SEQRES records: (download)

>d1dfca3 b.42.5.1 (A:1260-1382) Fascin {Human (Homo sapiens) [TaxId: 9606]}
caqvvlqaanernvstrqgmdlsanqdeetdqetfqleidrdtkkcafrthtgkywtlta
tggvqstassknascyfdiewrdrritlrasngkfvtskkngqlaasvetagdselflmk
lin

Sequence, based on observed residues (ATOM records): (download)

>d1dfca3 b.42.5.1 (A:1260-1382) Fascin {Human (Homo sapiens) [TaxId: 9606]}
caqvvlqaanernvstmdlsanqdeetdqetfqleidrdtkkcafrthtgkywtltatgg
vqstassknascyfdiewrdrritlrasngkfvtskkngqlaasvetagdselflmklin

SCOPe Domain Coordinates for d1dfca3:

Click to download the PDB-style file with coordinates for d1dfca3.
(The format of our PDB-style files is described here.)

Timeline for d1dfca3: