Lineage for d1f31a2 (1f31 A:1080-1290)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 59852Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 60012Superfamily b.42.4: STI-like [50386] (2 families) (S)
  5. 60041Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (2 proteins)
  6. 60042Protein Botulinum neurotoxin [50402] (2 species)
  7. 60045Species Clostridium botulinum, serotype B [TaxId:1491] [50404] (2 PDB entries)
  8. 60047Domain d1f31a2: 1f31 A:1080-1290 [25615]
    Other proteins in same PDB: d1f31a1, d1f31a3, d1f31a4

Details for d1f31a2

PDB Entry: 1f31 (more details), 2.6 Å

PDB Description: crystal structure of clostridium botulinum neurotoxin b complexed with a trisaccharide

SCOP Domain Sequences for d1f31a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f31a2 b.42.4.2 (A:1080-1290) Botulinum neurotoxin {Clostridium botulinum, serotype B}
seylkdfwgnplmynkeyymfnagnknsyiklkkdspvgeiltrskynqnskyinyrdly
igekfiirrksnsqsinddivrkedyiyldffnlnqewrvytykyfkkeeeklflapisd
sdefyntiqikeydeqptyscqllfkkdeestdeigligihrfyesgivfeeykdyfcis
kwylkevkrkpynlklgcnwqfipkdegwte

SCOP Domain Coordinates for d1f31a2:

Click to download the PDB-style file with coordinates for d1f31a2.
(The format of our PDB-style files is described here.)

Timeline for d1f31a2: