SCOPe 2.03: Domain d1epwa2: 1epw A:1080-1290

Lineage for d1epwa2 (1epw A:1080-1290)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.4: STI-like [50386] (3 families)

5. Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 proteins)
   overall fold is very similar to that of the STI family
   automatically mapped to Pfam PF07951

6. Protein Botulinum neurotoxin [50402] (2 species)

7. Species Clostridium botulinum, serotype B [TaxId:1491] [50404] (16 PDB entries)

8. Domain d1epwa2: 1epw A:1080-1290 [25614]
   Other proteins in same PDB: d1epwa1, d1epwa3, d1epwa4
   complexed with so4, zn

Details for d1epwa2

PDB Entry: 1epw, 1.9 Å

PDB Description: crystal structure of clostridium neurotoxin type b

PDB Compounds: (A:) botulinum neurotoxin type b

SCOPe Domain Sequences for d1epwa2:

Sequence; same for both SEQRES and ATOM records:

>d1epwa2 b.42.4.2 (A:1080-1290) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]}
seylkdfwgnplmynkeyymfnagnknsyiklkkdspvgeiltrskynqnskyinyrdly
igekfiirrksnsqsinddivrkedyiyldffnlnqewrvytykyfkkeeeklflapisd
sdefyntiqikeydeqptyscqllfkkdeestdeigligihrfyesgivfeeykdyfcis
kwylkevkrkpynlklgcnwqfipkdegwte

Timeline for d1epwa2:

• d1epwa2 first appeared (with stable ids) in SCOP 1.55
  
• d1epwa2 appears in SCOPe 2.02
  
• d1epwa2 appears in SCOPe 2.04
  
• d1epwa2 appears in the current release, SCOPe 2.08