Lineage for d1epwa2 (1epw A:1080-1290)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.42: beta-Trefoil [50352] (5 superfamilies) 
Superfamily b.42.4: STI-like [50386] (2 families) 
Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (2 proteins) 
Protein Botulinum neurotoxin [50402] (2 species) Species Clostridium botulinum, serotype B [TaxId:1491] [50404] (2 PDB entries) 
Domain d1epwa2: 1epw A:1080-1290 [25614]
Other proteins in same PDB: d1epwa1, d1epwa3, d1epwa4
Details for d1epwa2
PDB Entry: 1epw (more details), 1.9 Å
PDB Description: crystal structure of clostridium neurotoxin type b
SCOP Domain Sequences for d1epwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1epwa2 b.42.4.2 (A:1080-1290) Botulinum neurotoxin {Clostridium botulinum, serotype B}
seylkdfwgnplmynkeyymfnagnknsyiklkkdspvgeiltrskynqnskyinyrdly
igekfiirrksnsqsinddivrkedyiyldffnlnqewrvytykyfkkeeeklflapisd
sdefyntiqikeydeqptyscqllfkkdeestdeigligihrfyesgivfeeykdyfcis
kwylkevkrkpynlklgcnwqfipkdegwte
SCOP Domain Coordinates for d1epwa2:
Click to download the PDB-style file with coordinates for d1epwa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1epwa2:
- d1epwa2 appears in SCOP 1.57
- d1epwa2 appears in the current release, SCOPe 2.08
View in 3D
