Lineage for d1dfqa2 (1dfq A:1111-1315)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 298063Fold b.42: beta-Trefoil [50352] (6 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 298271Superfamily b.42.4: STI-like [50386] (2 families) (S)
  5. 298298Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (2 proteins)
    overall fold is very similar to that of the STI family
  6. 298310Protein Tetanus neurotoxin [50400] (1 species)
  7. 298311Species Clostridium tetani [50401] (8 PDB entries)
  8. 298320Domain d1dfqa2: 1dfq A:1111-1315 [25612]
    Other proteins in same PDB: d1dfqa1
    complexed with sia

Details for d1dfqa2

PDB Entry: 1dfq (more details), 2.6 Å

PDB Description: the hc fragment of tetanus toxin complexed with sialic acid

SCOP Domain Sequences for d1dfqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dfqa2 b.42.4.2 (A:1111-1315) Tetanus neurotoxin {Clostridium tetani}
itflrdfwgnplrydteyylipvassskdvqlknitdymyltnapsytngklniyyrrly
nglkfiikrytpnneidsfvksgdfiklyvsynnnehivgypkdgnafnnldrilrvgyn
apgiplykkmeavklrdlktysvqlklyddknaslglvgthngqigndpnrdiliasnwy
fnhlkdkilgcdwyfvptdegwtnd

SCOP Domain Coordinates for d1dfqa2:

Click to download the PDB-style file with coordinates for d1dfqa2.
(The format of our PDB-style files is described here.)

Timeline for d1dfqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dfqa1