Lineage for d1dfqa2 (1dfq A:1111-1315)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14401Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 14541Superfamily b.42.4: STI-like [50386] (2 families) (S)
  5. 14570Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (2 proteins)
  6. 14577Protein Tetanus neurotoxin [50400] (1 species)
  7. 14578Species Clostridium tetani [50401] (6 PDB entries)
  8. 14584Domain d1dfqa2: 1dfq A:1111-1315 [25612]
    Other proteins in same PDB: d1dfqa1

Details for d1dfqa2

PDB Entry: 1dfq (more details), 2.6 Å

PDB Description: the hc fragment of tetanus toxin complexed with sialic acid

SCOP Domain Sequences for d1dfqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dfqa2 b.42.4.2 (A:1111-1315) Tetanus neurotoxin {Clostridium tetani}
itflrdfwgnplrydteyylipvassskdvqlknitdymyltnapsytngklniyyrrly
nglkfiikrytpnneidsfvksgdfiklyvsynnnehivgypkdgnafnnldrilrvgyn
apgiplykkmeavklrdlktysvqlklyddknaslglvgthngqigndpnrdiliasnwy
fnhlkdkilgcdwyfvptdegwtnd

SCOP Domain Coordinates for d1dfqa2:

Click to download the PDB-style file with coordinates for d1dfqa2.
(The format of our PDB-style files is described here.)

Timeline for d1dfqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dfqa1