Class b: All beta proteins [48724] (165 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.4: STI-like [50386] (2 families) |
Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (2 proteins) overall fold is very similar to that of the STI family |
Protein Tetanus neurotoxin [50400] (1 species) |
Species Clostridium tetani [TaxId:1513] [50401] (10 PDB entries) |
Domain d1af9a2: 1af9 A:1111-1315 [25611] Other proteins in same PDB: d1af9a1 mutant |
PDB Entry: 1af9 (more details), 2.7 Å
SCOP Domain Sequences for d1af9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1af9a2 b.42.4.2 (A:1111-1315) Tetanus neurotoxin {Clostridium tetani [TaxId: 1513]} itflrdfwgnplrydteyylipvassskdvqlknitdymyltnapsytngklniyyrrly nglkfiikrytpnneidsfvksgdfiklyvsynnnehivgypkdgnafnnldrilrvgyn apgiplykkmeavklrdlktysvqlklyddknaslglvgthngqigndpnrdiliasnwy fnhlkdkilgcdwyfvptdegwtnd
Timeline for d1af9a2: