SCOP 1.73: Domain d1af9a2: 1af9 A:1111-1315

Lineage for d1af9a2 (1af9 A:1111-1315)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.4: STI-like [50386] (2 families)

5. Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (2 proteins)
   overall fold is very similar to that of the STI family

6. Protein Tetanus neurotoxin [50400] (1 species)

7. Species Clostridium tetani [TaxId:1513] [50401] (10 PDB entries)

8. Domain d1af9a2: 1af9 A:1111-1315 [25611]
   Other proteins in same PDB: d1af9a1
   mutant

Details for d1af9a2

PDB Entry: 1af9, 2.7 Å

PDB Description: tetanus neurotoxin c fragment

PDB Compounds: (A:) tetanus neurotoxin

SCOP Domain Sequences for d1af9a2:

Sequence; same for both SEQRES and ATOM records:

>d1af9a2 b.42.4.2 (A:1111-1315) Tetanus neurotoxin {Clostridium tetani [TaxId: 1513]}
itflrdfwgnplrydteyylipvassskdvqlknitdymyltnapsytngklniyyrrly
nglkfiikrytpnneidsfvksgdfiklyvsynnnehivgypkdgnafnnldrilrvgyn
apgiplykkmeavklrdlktysvqlklyddknaslglvgthngqigndpnrdiliasnwy
fnhlkdkilgcdwyfvptdegwtnd

Timeline for d1af9a2:

• d1af9a2 first appeared (with stable ids) in SCOP 1.55, called d1af9_2
  
• d1af9a2 was called d1af9_2 in SCOP 1.71
  
• d1af9a2 appears in SCOP 1.75
  
• d1af9a2 appears in the current release, SCOPe 2.08