Lineage for d1af9_2 (1af9 1111-1315)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 464258Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 464538Superfamily b.42.4: STI-like [50386] (2 families) (S)
  5. 464571Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (2 proteins)
    overall fold is very similar to that of the STI family
  6. 464589Protein Tetanus neurotoxin [50400] (1 species)
  7. 464590Species Clostridium tetani [50401] (8 PDB entries)
  8. 464595Domain d1af9_2: 1af9 1111-1315 [25611]
    Other proteins in same PDB: d1af9_1

Details for d1af9_2

PDB Entry: 1af9 (more details), 2.7 Å

PDB Description: tetanus neurotoxin c fragment

SCOP Domain Sequences for d1af9_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1af9_2 b.42.4.2 (1111-1315) Tetanus neurotoxin {Clostridium tetani}
itflrdfwgnplrydteyylipvassskdvqlknitdymyltnapsytngklniyyrrly
nglkfiikrytpnneidsfvksgdfiklyvsynnnehivgypkdgnafnnldrilrvgyn
apgiplykkmeavklrdlktysvqlklyddknaslglvgthngqigndpnrdiliasnwy
fnhlkdkilgcdwyfvptdegwtnd

SCOP Domain Coordinates for d1af9_2:

Click to download the PDB-style file with coordinates for d1af9_2.
(The format of our PDB-style files is described here.)

Timeline for d1af9_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1af9_1