Lineage for d1diwa2 (1diw A:1111-1315)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 375317Fold b.42: beta-Trefoil [50352] (6 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 375571Superfamily b.42.4: STI-like [50386] (2 families) (S)
  5. 375598Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (2 proteins)
    overall fold is very similar to that of the STI family
  6. 375616Protein Tetanus neurotoxin [50400] (1 species)
  7. 375617Species Clostridium tetani [50401] (8 PDB entries)
  8. 375620Domain d1diwa2: 1diw A:1111-1315 [25609]
    Other proteins in same PDB: d1diwa1
    complexed with gal

Details for d1diwa2

PDB Entry: 1diw (more details), 2 Å

PDB Description: the hc fragment of tetanus toxin complexed with galactose

SCOP Domain Sequences for d1diwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1diwa2 b.42.4.2 (A:1111-1315) Tetanus neurotoxin {Clostridium tetani}
itflrdfwgnplrydteyylipvassskdvqlknitdymyltnapsytngklniyyrrly
nglkfiikrytpnneidsfvksgdfiklyvsynnnehivgypkdgnafnnldrilrvgyn
apgiplykkmeavklrdlktysvqlklyddknaslglvgthngqigndpnrdiliasnwy
fnhlkdkilgcdwyfvptdegwtnd

SCOP Domain Coordinates for d1diwa2:

Click to download the PDB-style file with coordinates for d1diwa2.
(The format of our PDB-style files is described here.)

Timeline for d1diwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1diwa1