Lineage for d1a8d_2 (1a8d 248-452)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 560566Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 560866Superfamily b.42.4: STI-like [50386] (2 families) (S)
  5. 560899Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (2 proteins)
    overall fold is very similar to that of the STI family
  6. 560917Protein Tetanus neurotoxin [50400] (1 species)
  7. 560918Species Clostridium tetani [50401] (8 PDB entries)
  8. 560919Domain d1a8d_2: 1a8d 248-452 [25607]
    Other proteins in same PDB: d1a8d_1
    complexed with au; mutant

Details for d1a8d_2

PDB Entry: 1a8d (more details), 1.57 Å

PDB Description: tetanus toxin c fragment

SCOP Domain Sequences for d1a8d_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a8d_2 b.42.4.2 (248-452) Tetanus neurotoxin {Clostridium tetani}
itflrdfwgnplrydteyylipvassskdvqlknitdymyltnapsytngklniyyrrly
nglkfiikrytpnneidsfvksgdfiklyvsynnnehivgypkdgnafnnldrilrvgyn
apgiplykkmeavklrdlktysvqlklyddknaslglvgthngqigndpnrdiliasnwy
fnhlkdkilgcdwyfvptdegwtnd

SCOP Domain Coordinates for d1a8d_2:

Click to download the PDB-style file with coordinates for d1a8d_2.
(The format of our PDB-style files is described here.)

Timeline for d1a8d_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a8d_1