SCOP 1.67: Domain d1a8d_2: 1a8d 248-452

Lineage for d1a8d_2 (1a8d 248-452)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.42: beta-Trefoil [50352] (6 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.4: STI-like [50386] (2 families)

5. Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (2 proteins)
   overall fold is very similar to that of the STI family

6. Protein Tetanus neurotoxin [50400] (1 species)

7. Species Clostridium tetani [50401] (8 PDB entries)

8. Domain d1a8d_2: 1a8d 248-452 [25607]
   Other proteins in same PDB: d1a8d_1
   complexed with au; mutant

Details for d1a8d_2

PDB Entry: 1a8d, 1.57 Å

PDB Description: tetanus toxin c fragment

SCOP Domain Sequences for d1a8d_2:

Sequence; same for both SEQRES and ATOM records:

>d1a8d_2 b.42.4.2 (248-452) Tetanus neurotoxin {Clostridium tetani}
itflrdfwgnplrydteyylipvassskdvqlknitdymyltnapsytngklniyyrrly
nglkfiikrytpnneidsfvksgdfiklyvsynnnehivgypkdgnafnnldrilrvgyn
apgiplykkmeavklrdlktysvqlklyddknaslglvgthngqigndpnrdiliasnwy
fnhlkdkilgcdwyfvptdegwtnd

Timeline for d1a8d_2:

• d1a8d_2 first appeared (with stable ids) in SCOP 1.55
  
• d1a8d_2 appears in SCOP 1.65
  
• d1a8d_2 appears in SCOP 1.69
  
• d1a8d_2 appears in the current release, SCOPe 2.08, called d1a8da2