Lineage for d1avu__ (1avu -)
- Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds) 
Fold b.42: beta-Trefoil [50352] (8 superfamilies)
barrel, closed; n=6, S=12; and a hairpin triplet; meander
duplication: has internal pseudo threefold symmetry
Superfamily b.42.4: STI-like [50386] (2 families) 
Family b.42.4.1: Kunitz (STI) inhibitors [50387] (7 proteins) 
Protein Soybean trypsin inhibitor [50394] (1 species) Species Soybean (Glycine max) [TaxId:3847] [50395] (4 PDB entries) 
Domain d1avu__: 1avu - [25603]
Details for d1avu__
PDB Entry: 1avu (more details), 2.3 Å
PDB Description: trypsin inhibitor from soybean (sti)
SCOP Domain Sequences for d1avu__:
Sequence, based on SEQRES records: (download)
>d1avu__ b.42.4.1 (-) Soybean trypsin inhibitor {Soybean (Glycine max)}
dfvldnegnplenggtyyilsditafggiraaptgnercpltvvqsrneldkgigtiiss
pyrirfiaeghplslkfdsfavimlcvgiptewsvvedlpegpavkigenkdamdgwfrl
ervsddefnnyklvfcpqqaeddkcgdigisidhddgtrrlvvsknkplvvqfqkld
Sequence, based on observed residues (ATOM records): (download)
>d1avu__ b.42.4.1 (-) Soybean trypsin inhibitor {Soybean (Glycine max)}
dfvldnegnplenggtyyilsditafggiraaptgnercpltvvqsrneldkgigtiiss
pyrirfiaeghplslkfdsfavimlcvgiptewsvvedlpegpavkigenkdamdgwfrl
ervsefnnyklvfcpqqdkcgdigisidhddgtrrlvvsknkplvvqfqkld
SCOP Domain Coordinates for d1avu__:
Click to download the PDB-style file with coordinates for d1avu__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1avu__:
- d1avu__ first appeared (with stable ids) in SCOP 1.55
- d1avu__ appears in SCOP 1.67
- d1avu__ appears in SCOP 1.71
- d1avu__ appears in the current release, SCOPe 2.08, called d1avua_
View in 3D