![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.4: STI-like [50386] (3 families) ![]() |
![]() | Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 proteins) automatically mapped to Pfam PF00197 |
![]() | Protein Soybean trypsin inhibitor [50394] (1 species) |
![]() | Species Soybean (Glycine max) [TaxId:3847] [50395] (4 PDB entries) |
![]() | Domain d1ba7a_: 1ba7 A: [25601] |
PDB Entry: 1ba7 (more details), 2.5 Å
SCOPe Domain Sequences for d1ba7a_:
Sequence, based on SEQRES records: (download)
>d1ba7a_ b.42.4.1 (A:) Soybean trypsin inhibitor {Soybean (Glycine max) [TaxId: 3847]} dfvldnegnplenggtyyilsditafggiraaptgnercpltvvqsrneldkgigtiiss pyrirfiaeghplslkfdsfavimlcvgiptewsvvedlpegpavkigenkdamdgwfrl ervsddefnnyklvfcpqqaeddkcgdigisidhddgtrrlvvsknkplvvqfqkl
>d1ba7a_ b.42.4.1 (A:) Soybean trypsin inhibitor {Soybean (Glycine max) [TaxId: 3847]} dfvldnegnplenggtyyilsditafggiraaptgnercpltvvqsrneldkgigtiiss pyrirfiaeghplslkfdsfavimlcvgiptewsvvedlpegpavkigenkdamdgwfrl ervnnyklvfcpqcgdigisidhddgtrrlvvsknkplvvqfqkl
Timeline for d1ba7a_: