Lineage for d1ba7a_ (1ba7 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2384842Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2385622Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2385623Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 protein domains)
    automatically mapped to Pfam PF00197
  6. 2385647Protein Soybean trypsin inhibitor [50394] (1 species)
  7. 2385648Species Soybean (Glycine max) [TaxId:3847] [50395] (4 PDB entries)
  8. 2385651Domain d1ba7a_: 1ba7 A: [25601]

Details for d1ba7a_

PDB Entry: 1ba7 (more details), 2.5 Å

PDB Description: soybean trypsin inhibitor
PDB Compounds: (A:) trypsin inhibitor (kunitz)

SCOPe Domain Sequences for d1ba7a_:

Sequence, based on SEQRES records: (download)

>d1ba7a_ b.42.4.1 (A:) Soybean trypsin inhibitor {Soybean (Glycine max) [TaxId: 3847]}
dfvldnegnplenggtyyilsditafggiraaptgnercpltvvqsrneldkgigtiiss
pyrirfiaeghplslkfdsfavimlcvgiptewsvvedlpegpavkigenkdamdgwfrl
ervsddefnnyklvfcpqqaeddkcgdigisidhddgtrrlvvsknkplvvqfqkl

Sequence, based on observed residues (ATOM records): (download)

>d1ba7a_ b.42.4.1 (A:) Soybean trypsin inhibitor {Soybean (Glycine max) [TaxId: 3847]}
dfvldnegnplenggtyyilsditafggiraaptgnercpltvvqsrneldkgigtiiss
pyrirfiaeghplslkfdsfavimlcvgiptewsvvedlpegpavkigenkdamdgwfrl
ervnnyklvfcpqcgdigisidhddgtrrlvvsknkplvvqfqkl

SCOPe Domain Coordinates for d1ba7a_:

Click to download the PDB-style file with coordinates for d1ba7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ba7a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ba7b_