Lineage for d1avxb_ (1avx B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401196Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2402021Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2402022Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 proteins)
    automatically mapped to Pfam PF00197
  6. 2402046Protein Soybean trypsin inhibitor [50394] (1 species)
  7. 2402047Species Soybean (Glycine max) [TaxId:3847] [50395] (4 PDB entries)
  8. 2402049Domain d1avxb_: 1avx B: [25600]
    Other proteins in same PDB: d1avxa_
    complexed with ca

Details for d1avxb_

PDB Entry: 1avx (more details), 1.9 Å

PDB Description: complex porcine pancreatic trypsin/soybean trypsin inhibitor, tetragonal crystal form
PDB Compounds: (B:) trypsin inhibitor

SCOPe Domain Sequences for d1avxb_:

Sequence, based on SEQRES records: (download)

>d1avxb_ b.42.4.1 (B:) Soybean trypsin inhibitor {Soybean (Glycine max) [TaxId: 3847]}
dfvldnegnplenggtyyilsditafggiraaptgnercpltvvqsrneldkgigtiiss
pyrirfiaeghplslkfdsfavimlcvgiptewsvvedlpegpavkigenkdamdgwfrl
ervsddefnnyklvfcpqqaeddkcgdigisidhddgtrrlvvsknkplvvqfqkld

Sequence, based on observed residues (ATOM records): (download)

>d1avxb_ b.42.4.1 (B:) Soybean trypsin inhibitor {Soybean (Glycine max) [TaxId: 3847]}
dfvldnegnplenggtyyilsditafggiraaptgnercpltvvqsrneldkgigtiiss
pyrirfiaeghplslkfdsfavimlcvgiptewsvvedlpegpavkigenkdamdgwfrl
ervsddefnnyklvfcpqkcgdigisidhddgtrrlvvsknkplvvqfqkld

SCOPe Domain Coordinates for d1avxb_:

Click to download the PDB-style file with coordinates for d1avxb_.
(The format of our PDB-style files is described here.)

Timeline for d1avxb_: