Lineage for d1avxb_ (1avx B:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 167295Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 167492Superfamily b.42.4: STI-like [50386] (2 families) (S)
  5. 167493Family b.42.4.1: Kunitz (STI) inhibitors [50387] (5 proteins)
  6. 167511Protein Soybean trypsin inhibitor [50394] (1 species)
  7. 167512Species Soybean (Glycine max) [TaxId:3847] [50395] (4 PDB entries)
  8. 167514Domain d1avxb_: 1avx B: [25600]
    Other proteins in same PDB: d1avxa_

Details for d1avxb_

PDB Entry: 1avx (more details), 1.9 Å

PDB Description: complex porcine pancreatic trypsin/soybean trypsin inhibitor, tetragonal crystal form

SCOP Domain Sequences for d1avxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1avxb_ b.42.4.1 (B:) Soybean trypsin inhibitor {Soybean (Glycine max)}
dfvldnegnplenggtyyilsditafggiraaptgnercpltvvqsrneldkgigtiiss
pyrirfiaeghplslkfdsfavimlcvgiptewsvvedlpegpavkigenkdamdgwfrl
ervsddefnnyklvfcpqkcgdigisidhddgtrrlvvsknkplvvqfqkld

SCOP Domain Coordinates for d1avxb_:

Click to download the PDB-style file with coordinates for d1avxb_.
(The format of our PDB-style files is described here.)

Timeline for d1avxb_: