![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.4: STI-like [50386] (3 families) ![]() |
![]() | Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 proteins) automatically mapped to Pfam PF00197 |
![]() | Protein Soybean trypsin inhibitor [50394] (1 species) |
![]() | Species Soybean (Glycine max) [TaxId:3847] [50395] (4 PDB entries) |
![]() | Domain d1avxb_: 1avx B: [25600] Other proteins in same PDB: d1avxa_ complexed with ca |
PDB Entry: 1avx (more details), 1.9 Å
SCOPe Domain Sequences for d1avxb_:
Sequence, based on SEQRES records: (download)
>d1avxb_ b.42.4.1 (B:) Soybean trypsin inhibitor {Soybean (Glycine max) [TaxId: 3847]} dfvldnegnplenggtyyilsditafggiraaptgnercpltvvqsrneldkgigtiiss pyrirfiaeghplslkfdsfavimlcvgiptewsvvedlpegpavkigenkdamdgwfrl ervsddefnnyklvfcpqqaeddkcgdigisidhddgtrrlvvsknkplvvqfqkld
>d1avxb_ b.42.4.1 (B:) Soybean trypsin inhibitor {Soybean (Glycine max) [TaxId: 3847]} dfvldnegnplenggtyyilsditafggiraaptgnercpltvvqsrneldkgigtiiss pyrirfiaeghplslkfdsfavimlcvgiptewsvvedlpegpavkigenkdamdgwfrl ervsddefnnyklvfcpqkcgdigisidhddgtrrlvvsknkplvvqfqkld
Timeline for d1avxb_: