Lineage for d1avwb_ (1avw B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 464258Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 464538Superfamily b.42.4: STI-like [50386] (2 families) (S)
  5. 464539Family b.42.4.1: Kunitz (STI) inhibitors [50387] (7 proteins)
  6. 464558Protein Soybean trypsin inhibitor [50394] (1 species)
  7. 464559Species Soybean (Glycine max) [TaxId:3847] [50395] (4 PDB entries)
  8. 464560Domain d1avwb_: 1avw B: [25599]
    Other proteins in same PDB: d1avwa_

Details for d1avwb_

PDB Entry: 1avw (more details), 1.75 Å

PDB Description: complex porcine pancreatic trypsin/soybean trypsin inhibitor, orthorhombic crystal form

SCOP Domain Sequences for d1avwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1avwb_ b.42.4.1 (B:) Soybean trypsin inhibitor {Soybean (Glycine max)}
dfvldnegnplenggtyyilsditafggiraaptgnercpltvvqsrneldkgigtiiss
pyrirfiaeghplslkfdsfavimlcvgiptewsvvedlpegpavkigenkdamdgwfrl
ervsefnnyklvfcpqdkcgdigisidhddgtrrlvvsknkplvvqfqkld

SCOP Domain Coordinates for d1avwb_:

Click to download the PDB-style file with coordinates for d1avwb_.
(The format of our PDB-style files is described here.)

Timeline for d1avwb_: