Lineage for d1wbc__ (1wbc -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14401Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 14541Superfamily b.42.4: STI-like [50386] (2 families) (S)
  5. 14542Family b.42.4.1: Kunitz (STI) inhibitors [50387] (5 proteins)
  6. 14549Protein chymotrypsin inhibitor WCI [50392] (1 species)
  7. 14550Species Winged bean (Psophocarpus tetragonolobus) [TaxId:3891] [50393] (6 PDB entries)
  8. 14556Domain d1wbc__: 1wbc - [25598]

Details for d1wbc__

PDB Entry: 1wbc (more details), 2.95 Å

PDB Description: crystallization and preliminary x-ray studies of psophocarpin b1, a chymotrypsin inhibitor from winged bean seeds

SCOP Domain Sequences for d1wbc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wbc__ b.42.4.1 (-) chymotrypsin inhibitor WCI {Winged bean (Psophocarpus tetragonolobus)}
dddlvdaegnlvenggtyyllphiwahgggietaktgnepcpltvvrspnevskgepiri
ssqflslfiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilvfkfe
kvshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllkakseta
ssh

SCOP Domain Coordinates for d1wbc__:

Click to download the PDB-style file with coordinates for d1wbc__.
(The format of our PDB-style files is described here.)

Timeline for d1wbc__: