Lineage for d4wbca_ (4wbc A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.42: beta-Trefoil [50352] (8 superfamilies)
barrel, closed; n=6, S=12; and a hairpin triplet; meander
duplication: has internal pseudo threefold symmetry
Superfamily b.42.4: STI-like [50386] (3 families) 
Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 proteins)
automatically mapped to Pfam PF00197
Protein chymotrypsin inhibitor WCI [50392] (1 species) Species Winged bean (Psophocarpus tetragonolobus) [TaxId:3891] [50393] (8 PDB entries) 
Domain d4wbca_: 4wbc A: [25596]
complexed with so4
Details for d4wbca_
PDB Entry: 4wbc (more details), 2.14 Å
PDB Description: 2.13 a structure of a kunitz-type winged bean chymotrypsin inhibitor protein
PDB Compounds: (A:) protein (chymotrypsin inhibitor)SCOPe Domain Sequences for d4wbca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wbca_ b.42.4.1 (A:) chymotrypsin inhibitor WCI {Winged bean (Psophocarpus tetragonolobus) [TaxId: 3891]}
dddlvdaegnlvenggtyyllphiwahgggietaktgnepcpltvvrspnevskgepiri
ssqflslfiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilvfkfe
kvshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllkakseta
SCOPe Domain Coordinates for d4wbca_:
Click to download the PDB-style file with coordinates for d4wbca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4wbca_:
- d4wbca_ first appeared (with stable ids) in SCOP 1.55
- d4wbca_ appears in SCOPe 2.07
View in 3D