Lineage for d4wbca_ (4wbc A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2053108Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2053846Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2053847Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 protein domains)
    automatically mapped to Pfam PF00197
  6. 2053854Protein chymotrypsin inhibitor WCI [50392] (1 species)
  7. 2053855Species Winged bean (Psophocarpus tetragonolobus) [TaxId:3891] [50393] (8 PDB entries)
  8. 2053859Domain d4wbca_: 4wbc A: [25596]
    complexed with so4

Details for d4wbca_

PDB Entry: 4wbc (more details), 2.14 Å

PDB Description: 2.13 a structure of a kunitz-type winged bean chymotrypsin inhibitor protein
PDB Compounds: (A:) protein (chymotrypsin inhibitor)

SCOPe Domain Sequences for d4wbca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wbca_ b.42.4.1 (A:) chymotrypsin inhibitor WCI {Winged bean (Psophocarpus tetragonolobus) [TaxId: 3891]}
dddlvdaegnlvenggtyyllphiwahgggietaktgnepcpltvvrspnevskgepiri
ssqflslfiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilvfkfe
kvshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllkakseta

SCOPe Domain Coordinates for d4wbca_:

Click to download the PDB-style file with coordinates for d4wbca_.
(The format of our PDB-style files is described here.)

Timeline for d4wbca_: