Lineage for d1fn0a_ (1fn0 A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.42: beta-Trefoil [50352] (5 superfamilies) 
Superfamily b.42.4: STI-like [50386] (2 families) 
Family b.42.4.1: Kunitz (STI) inhibitors [50387] (5 proteins) 
Protein chymotrypsin inhibitor WCI [50392] (1 species) Species Winged bean (Psophocarpus tetragonolobus) [TaxId:3891] [50393] (6 PDB entries) 
Domain d1fn0a_: 1fn0 A: [25595]
Details for d1fn0a_
PDB Entry: 1fn0 (more details), 2 Å
PDB Description: structure of a mutant winged bean chymotrypsin inhibitor protein, n14d.
SCOP Domain Sequences for d1fn0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fn0a_ b.42.4.1 (A:) chymotrypsin inhibitor WCI {Winged bean (Psophocarpus tetragonolobus)}
dddlvdaegnlvedggtyyllphiwahgggietaktgnepcpltvvrspnevskgepiri
ssqflslfiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilvfkfe
kvshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllkaks
SCOP Domain Coordinates for d1fn0a_:
Click to download the PDB-style file with coordinates for d1fn0a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fn0a_:
- d1fn0a_ appears in SCOP 1.57
- d1fn0a_ appears in the current release, SCOPe 2.08
View in 3D