Lineage for d1fn0a_ (1fn0 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2792430Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2792431Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 proteins)
    automatically mapped to Pfam PF00197
  6. 2792438Protein chymotrypsin inhibitor WCI [50392] (1 species)
  7. 2792439Species Winged bean (Psophocarpus tetragonolobus) [TaxId:3891] [50393] (8 PDB entries)
  8. 2792441Domain d1fn0a_: 1fn0 A: [25595]
    complexed with so4; mutant

Details for d1fn0a_

PDB Entry: 1fn0 (more details), 2 Å

PDB Description: structure of a mutant winged bean chymotrypsin inhibitor protein, n14d.
PDB Compounds: (A:) Chymotrypsin inhibitor 3

SCOPe Domain Sequences for d1fn0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fn0a_ b.42.4.1 (A:) chymotrypsin inhibitor WCI {Winged bean (Psophocarpus tetragonolobus) [TaxId: 3891]}
dddlvdaegnlvedggtyyllphiwahgggietaktgnepcpltvvrspnevskgepiri
ssqflslfiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilvfkfe
kvshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllkaks

SCOPe Domain Coordinates for d1fn0a_:

Click to download the PDB-style file with coordinates for d1fn0a_.
(The format of our PDB-style files is described here.)

Timeline for d1fn0a_: