SCOPe 2.05: Domain d1fmza_: 1fmz A:

Lineage for d1fmza_ (1fmz A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.4: STI-like [50386] (3 families)

5. Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 proteins)
   automatically mapped to Pfam PF00197

6. Protein chymotrypsin inhibitor WCI [50392] (1 species)

7. Species Winged bean (Psophocarpus tetragonolobus) [TaxId:3891] [50393] (8 PDB entries)

8. Domain d1fmza_: 1fmz A: [25594]
   complexed with so4; mutant

Details for d1fmza_

PDB Entry: 1fmz, 2.05 Å

PDB Description: crystal structure of a mutant winged bean chymotrypsin inhibitor protein, n14k.

PDB Compounds: (A:) Chymotrypsin inhibitor 3

SCOPe Domain Sequences for d1fmza_:

Sequence; same for both SEQRES and ATOM records:

>d1fmza_ b.42.4.1 (A:) chymotrypsin inhibitor WCI {Winged bean (Psophocarpus tetragonolobus) [TaxId: 3891]}
efdddlvdaegnlvekggtyyllphiwahgggietaktgnepcpltvvrspnevskgepi
rissqflslfiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilvfk
fekvshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllkaks

Timeline for d1fmza_:

• d1fmza_ first appeared (with stable ids) in SCOP 1.55
  
• d1fmza_ appears in SCOPe 2.04
  
• d1fmza_ is called d1fmza1 in SCOPe 2.06
  
• d1fmza_ appears in the current release, SCOPe 2.08, called d1fmza1