Lineage for d1fmza1 (1fmz A:4-180)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2384842Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2385622Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2385623Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 protein domains)
    automatically mapped to Pfam PF00197
  6. 2385630Protein chymotrypsin inhibitor WCI [50392] (1 species)
  7. 2385631Species Winged bean (Psophocarpus tetragonolobus) [TaxId:3891] [50393] (8 PDB entries)
  8. 2385634Domain d1fmza1: 1fmz A:4-180 [25594]
    Other proteins in same PDB: d1fmza2
    complexed with so4; mutant

Details for d1fmza1

PDB Entry: 1fmz (more details), 2.05 Å

PDB Description: crystal structure of a mutant winged bean chymotrypsin inhibitor protein, n14k.
PDB Compounds: (A:) Chymotrypsin inhibitor 3

SCOPe Domain Sequences for d1fmza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fmza1 b.42.4.1 (A:4-180) chymotrypsin inhibitor WCI {Winged bean (Psophocarpus tetragonolobus) [TaxId: 3891]}
dddlvdaegnlvekggtyyllphiwahgggietaktgnepcpltvvrspnevskgepiri
ssqflslfiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilvfkfe
kvshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllkaks

SCOPe Domain Coordinates for d1fmza1:

Click to download the PDB-style file with coordinates for d1fmza1.
(The format of our PDB-style files is described here.)

Timeline for d1fmza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fmza2