Lineage for d1tiea_ (1tie A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2053108Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2053846Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2053847Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 protein domains)
    automatically mapped to Pfam PF00197
  6. 2053865Protein Erythrina cafra trypsin inhibitor [50390] (1 species)
  7. 2053866Species Erythrina caffra [TaxId:3842] [50391] (1 PDB entry)
  8. 2053867Domain d1tiea_: 1tie A: [25592]

Details for d1tiea_

PDB Entry: 1tie (more details), 2.5 Å

PDB Description: crystal structure of a kunitz-type trypsin inhibitor from erythrina caffra seeds
PDB Compounds: (A:) erythrina trypsin inhibitor

SCOPe Domain Sequences for d1tiea_:

Sequence, based on SEQRES records: (download)

>d1tiea_ b.42.4.1 (A:) Erythrina cafra trypsin inhibitor {Erythrina caffra [TaxId: 3842]}
vlldgngevvqnggtyyllpqvwaqgggvqlaktgeetcpltvvqspnelsdgkpiries
rlrsafipdddkvrigfayapkcapspwwtvvedeqeglsvklsedestqfdypfkfeqv
sdqlhsykllycegkhekcasiginrdqkgyrrlvvtedypltvvlkkde

Sequence, based on observed residues (ATOM records): (download)

>d1tiea_ b.42.4.1 (A:) Erythrina cafra trypsin inhibitor {Erythrina caffra [TaxId: 3842]}
vlldgngevvqnggtyyllpqvwaqgggvqlaktgeetcpltvvqspnelsdgkpiries
rlrsafipdddkvrigfayapkcapspwwtvveglsvklsedestqfdypfkfeqvsdql
hsykllycegkhekcasiginrdqkgyrrlvvtedypltvvlkkde

SCOPe Domain Coordinates for d1tiea_:

Click to download the PDB-style file with coordinates for d1tiea_.
(The format of our PDB-style files is described here.)

Timeline for d1tiea_: