Lineage for d1wbaa_ (1wba A:)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.42: beta-Trefoil [50352] (8 superfamilies)
barrel, closed; n=6, S=12; and a hairpin triplet; meander
duplication: has internal pseudo threefold symmetry
Superfamily b.42.4: STI-like [50386] (3 families) 
Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 proteins)
automatically mapped to Pfam PF00197
Protein Winged bean albumin 1 [50388] (1 species) Species Winged bean (Psophocarpus tetragonolobus) [TaxId:3891] [50389] (1 PDB entry) 
Domain d1wbaa_: 1wba A: [25591]
Details for d1wbaa_
PDB Entry: 1wba (more details), 1.8 Å
PDB Description: winged bean albumin 1
PDB Compounds: (A:) winged bean albumin 1SCOPe Domain Sequences for d1wbaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wbaa_ b.42.4.1 (A:) Winged bean albumin 1 {Winged bean (Psophocarpus tetragonolobus) [TaxId: 3891]}
ddpvydaegnklvnrgkytivsfsdgagidvvatgnenpedplsivkstrnimyatsiss
edktppqprnilenmrlkinfatdphkgdvwsvvdfqpdgqqlklagrypnqvkgaftiq
kgsntprtykllfcpvgspcknigistdpegkkrlvvsyqsdplvvkfhrh
SCOPe Domain Coordinates for d1wbaa_:
Click to download the PDB-style file with coordinates for d1wbaa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wbaa_:
- d1wbaa_ first appeared (with stable ids) in SCOP 1.55, called d1wba__
- d1wbaa_ appears in SCOPe 2.06
- d1wbaa_ appears in the current release, SCOPe 2.08
View in 3D