Lineage for d1wbaa_ (1wba A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401196Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2402021Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2402022Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 proteins)
    automatically mapped to Pfam PF00197
  6. 2402056Protein Winged bean albumin 1 [50388] (1 species)
  7. 2402057Species Winged bean (Psophocarpus tetragonolobus) [TaxId:3891] [50389] (1 PDB entry)
  8. 2402058Domain d1wbaa_: 1wba A: [25591]

Details for d1wbaa_

PDB Entry: 1wba (more details), 1.8 Å

PDB Description: winged bean albumin 1
PDB Compounds: (A:) winged bean albumin 1

SCOPe Domain Sequences for d1wbaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wbaa_ b.42.4.1 (A:) Winged bean albumin 1 {Winged bean (Psophocarpus tetragonolobus) [TaxId: 3891]}
ddpvydaegnklvnrgkytivsfsdgagidvvatgnenpedplsivkstrnimyatsiss
edktppqprnilenmrlkinfatdphkgdvwsvvdfqpdgqqlklagrypnqvkgaftiq
kgsntprtykllfcpvgspcknigistdpegkkrlvvsyqsdplvvkfhrh

SCOPe Domain Coordinates for d1wbaa_:

Click to download the PDB-style file with coordinates for d1wbaa_.
(The format of our PDB-style files is described here.)

Timeline for d1wbaa_: