Class b: All beta proteins [48724] (180 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.3: Agglutinin [50382] (1 family) this superfamily is distinct from the ricin B-like lectin superfamily automatically mapped to Pfam PF07468 |
Family b.42.3.1: Agglutinin [50383] (1 protein) |
Protein Agglutinin [50384] (1 species) duplication: the tandem repeat of beta-trefoil domains |
Species Love-lies-bleeding (Amaranthus caudatus) [TaxId:3567] [50385] (2 PDB entries) |
Domain d1jlyb2: 1jly B:154-299 [25590] |
PDB Entry: 1jly (more details), 2.2 Å
SCOPe Domain Sequences for d1jlyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jlyb2 b.42.3.1 (B:154-299) Agglutinin {Love-lies-bleeding (Amaranthus caudatus) [TaxId: 3567]} wksifqfpkgyvtfkgnngkylgvitinqlpclqfgydnlndpkvahqmfvtsngticik snymnkfwrlstddwilvdgndpretneaaalfrsdvhdfnvisllnmqktwfikrftsg kpgfincmnaatqnvdetaileiiel
Timeline for d1jlyb2: