Lineage for d1jlyb2 (1jly B:154-299)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2792418Superfamily b.42.3: Agglutinin [50382] (1 family) (S)
    this superfamily is distinct from the ricin B-like lectin superfamily
    automatically mapped to Pfam PF07468
  5. 2792419Family b.42.3.1: Agglutinin [50383] (1 protein)
  6. 2792420Protein Agglutinin [50384] (1 species)
    duplication: the tandem repeat of beta-trefoil domains
  7. 2792421Species Love-lies-bleeding (Amaranthus caudatus) [TaxId:3567] [50385] (2 PDB entries)
  8. 2792425Domain d1jlyb2: 1jly B:154-299 [25590]

Details for d1jlyb2

PDB Entry: 1jly (more details), 2.2 Å

PDB Description: crystal structure of amaranthus caudatus agglutinin
PDB Compounds: (B:) agglutinin

SCOPe Domain Sequences for d1jlyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jlyb2 b.42.3.1 (B:154-299) Agglutinin {Love-lies-bleeding (Amaranthus caudatus) [TaxId: 3567]}
wksifqfpkgyvtfkgnngkylgvitinqlpclqfgydnlndpkvahqmfvtsngticik
snymnkfwrlstddwilvdgndpretneaaalfrsdvhdfnvisllnmqktwfikrftsg
kpgfincmnaatqnvdetaileiiel

SCOPe Domain Coordinates for d1jlyb2:

Click to download the PDB-style file with coordinates for d1jlyb2.
(The format of our PDB-style files is described here.)

Timeline for d1jlyb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jlyb1