Lineage for d1jlya1 (1jly A:1-153)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14401Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 14529Superfamily b.42.3: Agglutinin [50382] (1 family) (S)
  5. 14530Family b.42.3.1: Agglutinin [50383] (1 protein)
  6. 14531Protein Agglutinin [50384] (1 species)
  7. 14532Species Love-lies-bleeding (Amaranthus caudatus) [TaxId:3567] [50385] (2 PDB entries)
  8. 14537Domain d1jlya1: 1jly A:1-153 [25587]

Details for d1jlya1

PDB Entry: 1jly (more details), 2.2 Å

PDB Description: crystal structure of amaranthus caudatus agglutinin

SCOP Domain Sequences for d1jlya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jlya1 b.42.3.1 (A:1-153) Agglutinin {Love-lies-bleeding (Amaranthus caudatus)}
aglpvimclksnnhqkylryqsdniqqygllqfsadkildplaqfevepsktydglvhik
srytnkylvrwspnhywitasanepdenksnwactlfkplyveegnmkkvrllhvqlghy
tqnytvggsfvsylfaessqidtgskdvfhvid

SCOP Domain Coordinates for d1jlya1:

Click to download the PDB-style file with coordinates for d1jlya1.
(The format of our PDB-style files is described here.)

Timeline for d1jlya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jlya2