SCOPe 2.05: Domain d1jlxb1: 1jlx B:1-153

Lineage for d1jlxb1 (1jlx B:1-153)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.3: Agglutinin [50382] (1 family)
   this superfamily is distinct from the ricin B-like lectin superfamily
   automatically mapped to Pfam PF07468

5. Family b.42.3.1: Agglutinin [50383] (1 protein)

6. Protein Agglutinin [50384] (1 species)
   duplication: the tandem repeat of beta-trefoil domains

7. Species Love-lies-bleeding (Amaranthus caudatus) [TaxId:3567] [50385] (2 PDB entries)

8. Domain d1jlxb1: 1jlx B:1-153 [25585]
   complexed with for, mbn

Details for d1jlxb1

PDB Entry: 1jlx, 2.2 Å

PDB Description: agglutinin in complex with t-disaccharide

PDB Compounds: (B:) agglutinin

SCOPe Domain Sequences for d1jlxb1:

Sequence; same for both SEQRES and ATOM records:

>d1jlxb1 b.42.3.1 (B:1-153) Agglutinin {Love-lies-bleeding (Amaranthus caudatus) [TaxId: 3567]}
aglpvimclksnnhqkylryqsdniqqygllqfsadkildplaqfevepsktydglvhik
srytnkylvrwspnhywitasanepdenksnwactlfkplyveegnmkkvrllhvqlghy
tqnytvggsfvsylfaessqidtgskdvfhvid

Timeline for d1jlxb1:

• d1jlxb1 first appeared (with stable ids) in SCOP 1.55
  
• d1jlxb1 appears in SCOPe 2.04
  
• d1jlxb1 appears in SCOPe 2.06
  
• d1jlxb1 appears in the current release, SCOPe 2.08