Lineage for d1fwua_ (1fwu A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1790651Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1791069Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 1791265Family b.42.2.2: Cysteine rich domain [50379] (1 protein)
  6. 1791266Protein Mannose receptor [50380] (1 species)
  7. 1791267Species Mouse (Mus musculus) [TaxId:10090] [50381] (4 PDB entries)
  8. 1791269Domain d1fwua_: 1fwu A: [25580]

Details for d1fwua_

PDB Entry: 1fwu (more details), 1.9 Å

PDB Description: crystal structure of the cysteine-rich domain of mannose receptor complexed with 3-so4-lewis(x)
PDB Compounds: (A:) cysteine-rich domain of mannose receptor

SCOPe Domain Sequences for d1fwua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fwua_ b.42.2.2 (A:) Mannose receptor {Mouse (Mus musculus) [TaxId: 10090]}
darqfliynedhkrcvdalsaisvqtatcnpeaesqkfrwvsdsqimsvafklclgvpsk
tdwasvtlyacdskseyqkweckndtlfgikgtelyfnygnrqekniklykgsglwsrwk
vygttddlcsrgye

SCOPe Domain Coordinates for d1fwua_:

Click to download the PDB-style file with coordinates for d1fwua_.
(The format of our PDB-style files is described here.)

Timeline for d1fwua_: