Lineage for d1fwua_ (1fwu A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.42: beta-Trefoil [50352] (5 superfamilies) 
Superfamily b.42.2: Ricin B-like lectins [50370] (2 families) 
Family b.42.2.2: Cysteine rich domain [50379] (1 protein) Protein Mannose receptor [50380] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [50381] (4 PDB entries) 
Domain d1fwua_: 1fwu A: [25580]
Details for d1fwua_
PDB Entry: 1fwu (more details), 1.9 Å
PDB Description: crystal structure of the cysteine-rich domain of mannose receptor complexed with 3-so4-lewis(x)
SCOP Domain Sequences for d1fwua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fwua_ b.42.2.2 (A:) Mannose receptor {Mouse (Mus musculus)}
darqfliynedhkrcvdalsaisvqtatcnpeaesqkfrwvsdsqimsvafklclgvpsk
tdwasvtlyacdskseyqkweckndtlfgikgtelyfnygnrqekniklykgsglwsrwk
vygttddlcsrgye
SCOP Domain Coordinates for d1fwua_:
Click to download the PDB-style file with coordinates for d1fwua_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fwua_:
- d1fwua_ appears in SCOP 1.57
- d1fwua_ appears in the current release, SCOPe 2.08
View in 3D