Lineage for d1xyfb1 (1xyf B:813-936)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 59852Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 59966Superfamily b.42.2: Ricin B-like lectins [50370] (2 families) (S)
  5. 59967Family b.42.2.1: Ricin B-like [50371] (2 proteins)
  6. 59968Protein Endo-1,4-beta-xylanase C-terminal domain [50377] (1 species)
  7. 59969Species Streptomyces olivaceoviridis [TaxId:1921] [50378] (1 PDB entry)
  8. 59971Domain d1xyfb1: 1xyf B:813-936 [25578]
    Other proteins in same PDB: d1xyfa2, d1xyfb2

Details for d1xyfb1

PDB Entry: 1xyf (more details), 1.9 Å

PDB Description: endo-1,4-beta-xylanase from streptomyces olivaceoviridis

SCOP Domain Sequences for d1xyfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xyfb1 b.42.2.1 (B:813-936) Endo-1,4-beta-xylanase C-terminal domain {Streptomyces olivaceoviridis}
gqikgvgsgrcldvpnasttdgtqvqlydchsatnqqwtytdagelrvygdkcldaagtg
ngtkvqiyscwggdnqkwrlnsdgsivgvqsglcldavgggtangtliqlyscsngsnqr
wtrt

SCOP Domain Coordinates for d1xyfb1:

Click to download the PDB-style file with coordinates for d1xyfb1.
(The format of our PDB-style files is described here.)

Timeline for d1xyfb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xyfb2