Lineage for d1hwpb2 (1hwp B:136-264)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111051Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 111186Superfamily b.42.2: Ricin B-like lectins [50370] (2 families) (S)
  5. 111187Family b.42.2.1: Ricin B-like [50371] (2 proteins)
  6. 111204Protein Plant cytotoxin B-chain (lectin) [50372] (4 species)
  7. 111216Species Sambucus ebulus, ebulin [TaxId:28503] [50376] (4 PDB entries)
  8. 111224Domain d1hwpb2: 1hwp B:136-264 [25576]
    Other proteins in same PDB: d1hwpa_

Details for d1hwpb2

PDB Entry: 1hwp (more details), 3.1 Å

PDB Description: ebulin complexed with pteroic acid, trigonal crystal form

SCOP Domain Sequences for d1hwpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwpb2 b.42.2.1 (B:136-264) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin}
dvqpiatlivgynemclqangennnvwmedcdvtsvqqqwalfddrtirvnnsrglcvts
ngyvskdlivirkcqglatqrwffnsdgsvvnlkstrvmdvkesdvslqeviifpatgnp
nqqwrtqvp

SCOP Domain Coordinates for d1hwpb2:

Click to download the PDB-style file with coordinates for d1hwpb2.
(The format of our PDB-style files is described here.)

Timeline for d1hwpb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hwpb1
View in 3D
Domains from other chains:
(mouse over for more information)
d1hwpa_