SCOPe 2.07: Domain d1hwnb2: 1hwn B:136-264

Lineage for d1hwnb2 (1hwn B:136-264)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.1: Ricin B-like [50371] (11 proteins)

6. Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
   duplication: consists of two domains of this fold

7. Species Sambucus ebulus, ebulin [TaxId:28503] [50376] (4 PDB entries)

8. Domain d1hwnb2: 1hwn B:136-264 [25574]
   Other proteins in same PDB: d1hwna_
   complexed with gal, nag

Details for d1hwnb2

PDB Entry: 1hwn, 2.8 Å

PDB Description: ebulin complexed with galactose, trigonal crystal form

PDB Compounds: (B:) ebulin

SCOPe Domain Sequences for d1hwnb2:

Sequence; same for both SEQRES and ATOM records:

>d1hwnb2 b.42.2.1 (B:136-264) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]}
dvqpiatlivgynemclqangennnvwmedcdvtsvqqqwalfddrtirvnnsrglcvts
ngyvskdlivirkcqglatqrwffnsdgsvvnlkstrvmdvkesdvslqeviifpatgnp
nqqwrtqvp

Timeline for d1hwnb2:

• d1hwnb2 first appeared (with stable ids) in SCOP 1.55
  
• d1hwnb2 appears in SCOPe 2.06
  
• d1hwnb2 appears in the current release, SCOPe 2.08