Class b: All beta proteins [48724] (126 folds) |
Fold b.42: beta-Trefoil [50352] (6 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (2 families) |
Family b.42.2.1: Ricin B-like [50371] (2 proteins) |
Protein Plant cytotoxin B-chain (lectin) [50372] (5 species) duplication: consists of two domains of this fold |
Species Sambucus ebulus, ebulin [TaxId:28503] [50376] (4 PDB entries) |
Domain d1hwnb2: 1hwn B:136-264 [25574] Other proteins in same PDB: d1hwna_ complexed with gal, nag |
PDB Entry: 1hwn (more details), 2.8 Å
SCOP Domain Sequences for d1hwnb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hwnb2 b.42.2.1 (B:136-264) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin} dvqpiatlivgynemclqangennnvwmedcdvtsvqqqwalfddrtirvnnsrglcvts ngyvskdlivirkcqglatqrwffnsdgsvvnlkstrvmdvkesdvslqeviifpatgnp nqqwrtqvp
Timeline for d1hwnb2: