Lineage for d1hwnb1 (1hwn B:2-135)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14401Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 14495Superfamily b.42.2: Ricin B-like lectins [50370] (2 families) (S)
  5. 14496Family b.42.2.1: Ricin B-like [50371] (2 proteins)
  6. 14501Protein Plant cytotoxin B-chain (lectin) [50372] (4 species)
  7. 14513Species Sambucus ebulus, ebulin [TaxId:28503] [50376] (4 PDB entries)
  8. 14518Domain d1hwnb1: 1hwn B:2-135 [25573]
    Other proteins in same PDB: d1hwna_

Details for d1hwnb1

PDB Entry: 1hwn (more details), 2.8 Å

PDB Description: ebulin complexed with galactose, trigonal crystal form

SCOP Domain Sequences for d1hwnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwnb1 b.42.2.1 (B:2-135) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin}
getcaipapftrrivgrdglcvdvrngydtdgtpiqlwpcgtqrnqqwtfyndktirsmg
kcmtanglnsgsyimitdcstaaedatkwevlidgsiinpssglvmtapsgasrttllle
nnihaasqgwtvsn

SCOP Domain Coordinates for d1hwnb1:

Click to download the PDB-style file with coordinates for d1hwnb1.
(The format of our PDB-style files is described here.)

Timeline for d1hwnb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hwnb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1hwna_