SCOP 1.65: Domain d1hwob2: 1hwo B:136-264

Lineage for d1hwob2 (1hwo B:136-264)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.42: beta-Trefoil [50352] (6 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (2 families)

5. Family b.42.2.1: Ricin B-like [50371] (2 proteins)

6. Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
   duplication: consists of two domains of this fold

7. Species Sambucus ebulus, ebulin [TaxId:28503] [50376] (4 PDB entries)

8. Domain d1hwob2: 1hwo B:136-264 [25572]
   Other proteins in same PDB: d1hwoa_
   complexed with gal, glc, man, nag

Details for d1hwob2

PDB Entry: 1hwo, 2.9 Å

PDB Description: ebulin complexed with lactose, trigonal crystal form

SCOP Domain Sequences for d1hwob2:

Sequence; same for both SEQRES and ATOM records:

>d1hwob2 b.42.2.1 (B:136-264) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin}
dvqpiatlivgynemclqangennnvwmedcdvtsvqqqwalfddrtirvnnsrglcvts
ngyvskdlivirkcqglatqrwffnsdgsvvnlkstrvmdvkesdvslqeviifpatgnp
nqqwrtqvp

Timeline for d1hwob2:

• d1hwob2 first appeared (with stable ids) in SCOP 1.55
  
• d1hwob2 appears in SCOP 1.63
  
• d1hwob2 appears in SCOP 1.67
  
• d1hwob2 appears in the current release, SCOPe 2.08