SCOPe 2.07: Domain d1hwob1: 1hwo B:2-135

Lineage for d1hwob1 (1hwo B:2-135)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.1: Ricin B-like [50371] (11 proteins)

6. Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
   duplication: consists of two domains of this fold

7. Species Sambucus ebulus, ebulin [TaxId:28503] [50376] (4 PDB entries)

8. Domain d1hwob1: 1hwo B:2-135 [25571]
   Other proteins in same PDB: d1hwoa_
   complexed with bma, gal, glc, nag

Details for d1hwob1

PDB Entry: 1hwo, 2.9 Å

PDB Description: ebulin complexed with lactose, trigonal crystal form

PDB Compounds: (B:) ebulin

SCOPe Domain Sequences for d1hwob1:

Sequence; same for both SEQRES and ATOM records:

>d1hwob1 b.42.2.1 (B:2-135) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]}
getcaipapftrrivgrdglcvdvrngydtdgtpiqlwpcgtqrnqqwtfyndktirsmg
kcmtanglnsgsyimitdcstaaedatkwevlidgsiinpssglvmtapsgasrttllle
nnihaasqgwtvsn

Timeline for d1hwob1:

• d1hwob1 first appeared (with stable ids) in SCOP 1.55
  
• d1hwob1 appears in SCOPe 2.06
  
• d1hwob1 appears in the current release, SCOPe 2.08