Lineage for d1hwob1 (1hwo B:2-135)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1316302Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1316646Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 1316647Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 1316728Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
    duplication: consists of two domains of this fold
  7. 1316771Species Sambucus ebulus, ebulin [TaxId:28503] [50376] (4 PDB entries)
  8. 1316774Domain d1hwob1: 1hwo B:2-135 [25571]
    Other proteins in same PDB: d1hwoa_

Details for d1hwob1

PDB Entry: 1hwo (more details), 2.9 Å

PDB Description: ebulin complexed with lactose, trigonal crystal form
PDB Compounds: (B:) ebulin

SCOPe Domain Sequences for d1hwob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwob1 b.42.2.1 (B:2-135) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]}
getcaipapftrrivgrdglcvdvrngydtdgtpiqlwpcgtqrnqqwtfyndktirsmg
kcmtanglnsgsyimitdcstaaedatkwevlidgsiinpssglvmtapsgasrttllle
nnihaasqgwtvsn

SCOPe Domain Coordinates for d1hwob1:

Click to download the PDB-style file with coordinates for d1hwob1.
(The format of our PDB-style files is described here.)

Timeline for d1hwob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hwob2
View in 3D
Domains from other chains:
(mouse over for more information)
d1hwoa_