Lineage for d1hwob1 (1hwo B:2-135)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 59852Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 59966Superfamily b.42.2: Ricin B-like lectins [50370] (2 families) (S)
  5. 59967Family b.42.2.1: Ricin B-like [50371] (2 proteins)
  6. 59972Protein Plant cytotoxin B-chain (lectin) [50372] (4 species)
  7. 59984Species Sambucus ebulus, ebulin [TaxId:28503] [50376] (4 PDB entries)
  8. 59987Domain d1hwob1: 1hwo B:2-135 [25571]
    Other proteins in same PDB: d1hwoa_

Details for d1hwob1

PDB Entry: 1hwo (more details), 2.9 Å

PDB Description: ebulin complexed with lactose, trigonal crystal form

SCOP Domain Sequences for d1hwob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwob1 b.42.2.1 (B:2-135) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin}
getcaipapftrrivgrdglcvdvrngydtdgtpiqlwpcgtqrnqqwtfyndktirsmg
kcmtanglnsgsyimitdcstaaedatkwevlidgsiinpssglvmtapsgasrttllle
nnihaasqgwtvsn

SCOP Domain Coordinates for d1hwob1:

Click to download the PDB-style file with coordinates for d1hwob1.
(The format of our PDB-style files is described here.)

Timeline for d1hwob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hwob2
View in 3D
Domains from other chains:
(mouse over for more information)
d1hwoa_