Lineage for d1hwmb2 (1hwm B:136-266)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111051Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 111186Superfamily b.42.2: Ricin B-like lectins [50370] (2 families) (S)
  5. 111187Family b.42.2.1: Ricin B-like [50371] (2 proteins)
  6. 111204Protein Plant cytotoxin B-chain (lectin) [50372] (4 species)
  7. 111216Species Sambucus ebulus, ebulin [TaxId:28503] [50376] (4 PDB entries)
  8. 111218Domain d1hwmb2: 1hwm B:136-266 [25570]
    Other proteins in same PDB: d1hwma_

Details for d1hwmb2

PDB Entry: 1hwm (more details), 2.8 Å

PDB Description: ebulin,orthorhombic crystal form model

SCOP Domain Sequences for d1hwmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwmb2 b.42.2.1 (B:136-266) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin}
dvqpiatlivgynemclqangennnvwmedcdvtsvqqqwalfddrtirvnnsrglcvts
ngyvskdlivirkcqglatqrwffnsdgsvvnlkstrvmdvkesdvslqeviifpatgnp
nqqwrtqvpqi

SCOP Domain Coordinates for d1hwmb2:

Click to download the PDB-style file with coordinates for d1hwmb2.
(The format of our PDB-style files is described here.)

Timeline for d1hwmb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hwmb1
View in 3D
Domains from other chains:
(mouse over for more information)
d1hwma_