Lineage for d2mllb2 (2mll B:134-255)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401196Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2401663Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2401664Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 2401750Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
    duplication: consists of two domains of this fold
  7. 2401763Species European mistletoe (Viscum album) [TaxId:3972] [50375] (12 PDB entries)
    different sequence variants
    Uniprot Q6ITZ3 266-520; Uniprot P81446 269-531 # 91% sequence identity
  8. 2401785Domain d2mllb2: 2mll B:134-255 [25568]
    Other proteins in same PDB: d2mlla_
    complexed with nag

Details for d2mllb2

PDB Entry: 2mll (more details), 2.7 Å

PDB Description: mistletoe lectin i from viscum album
PDB Compounds: (B:) protein (ribosome-inactivating protein type II)

SCOPe Domain Sequences for d2mllb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mllb2 b.42.2.1 (B:134-255) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]}
taprevtiygfndlcmesgggsvtvetcssgkadkwalygdgsirpeqnqaqcltsggds
vagvnivscsgaasgqrwvftnegailnlknglamdvanpgggriiiypatgkpnqmwlp
vf

SCOPe Domain Coordinates for d2mllb2:

Click to download the PDB-style file with coordinates for d2mllb2.
(The format of our PDB-style files is described here.)

Timeline for d2mllb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mllb1
View in 3D
Domains from other chains:
(mouse over for more information)
d2mlla_