SCOP 1.69: Domain d1abrb2: 1abr B:141-267

Lineage for d1abrb2 (1abr B:141-267)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (2 families)

5. Family b.42.2.1: Ricin B-like [50371] (6 proteins)

6. Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
   duplication: consists of two domains of this fold

7. Species Abrus precatorius [TaxId:3816] [50374] (1 PDB entry)

8. Domain d1abrb2: 1abr B:141-267 [25564]
   Other proteins in same PDB: d1abra_

Details for d1abrb2

PDB Entry: 1abr, 2.14 Å

PDB Description: crystal structure of abrin-a

SCOP Domain Sequences for d1abrb2:

Sequence; same for both SEQRES and ATOM records:

>d1abrb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Abrus precatorius}
ntspfvtsisgysdlcmqaqgsnvwmadcdsnkkeqqwalytdgsirsvqntnncltskd
hkqgstillmgcsngwasqrwvfkndgsiyslyddmvmdvkgsdpslkqiilwpytgkpn
qiwltlf

Timeline for d1abrb2:

• d1abrb2 first appeared (with stable ids) in SCOP 1.55
  
• d1abrb2 appears in SCOP 1.67
  
• d1abrb2 appears in SCOP 1.71
  
• d1abrb2 appears in the current release, SCOPe 2.08