Lineage for d1abrb2 (1abr B:141-267)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 59852Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 59966Superfamily b.42.2: Ricin B-like lectins [50370] (2 families) (S)
  5. 59967Family b.42.2.1: Ricin B-like [50371] (2 proteins)
  6. 59972Protein Plant cytotoxin B-chain (lectin) [50372] (4 species)
  7. 59973Species Abrus precatorius [TaxId:3816] [50374] (1 PDB entry)
  8. 59975Domain d1abrb2: 1abr B:141-267 [25564]
    Other proteins in same PDB: d1abra_

Details for d1abrb2

PDB Entry: 1abr (more details), 2.14 Å

PDB Description: crystal structure of abrin-a

SCOP Domain Sequences for d1abrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1abrb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Abrus precatorius}
ntspfvtsisgysdlcmqaqgsnvwmadcdsnkkeqqwalytdgsirsvqntnncltskd
hkqgstillmgcsngwasqrwvfkndgsiyslyddmvmdvkgsdpslkqiilwpytgkpn
qiwltlf

SCOP Domain Coordinates for d1abrb2:

Click to download the PDB-style file with coordinates for d1abrb2.
(The format of our PDB-style files is described here.)

Timeline for d1abrb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1abrb1
View in 3D
Domains from other chains:
(mouse over for more information)
d1abra_