Lineage for d1abrb2 (1abr B:141-267)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2792072Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2792073Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 2792159Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
    duplication: consists of two domains of this fold
  7. 2792160Species Abrus precatorius [TaxId:3816] [50374] (1 PDB entry)
  8. 2792162Domain d1abrb2: 1abr B:141-267 [25564]
    Other proteins in same PDB: d1abra_

Details for d1abrb2

PDB Entry: 1abr (more details), 2.14 Å

PDB Description: crystal structure of abrin-a
PDB Compounds: (B:) abrin-a

SCOPe Domain Sequences for d1abrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1abrb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]}
ntspfvtsisgysdlcmqaqgsnvwmadcdsnkkeqqwalytdgsirsvqntnncltskd
hkqgstillmgcsngwasqrwvfkndgsiyslyddmvmdvkgsdpslkqiilwpytgkpn
qiwltlf

SCOPe Domain Coordinates for d1abrb2:

Click to download the PDB-style file with coordinates for d1abrb2.
(The format of our PDB-style files is described here.)

Timeline for d1abrb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1abrb1
View in 3D
Domains from other chains:
(mouse over for more information)
d1abra_