![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (6 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.2: Ricin B-like lectins [50370] (2 families) ![]() |
![]() | Family b.42.2.1: Ricin B-like [50371] (2 proteins) |
![]() | Protein Plant cytotoxin B-chain (lectin) [50372] (4 species) duplication: consists of two domains of this fold |
![]() | Species Abrus precatorius [TaxId:3816] [50374] (1 PDB entry) |
![]() | Domain d1abrb1: 1abr B:1-140 [25563] Other proteins in same PDB: d1abra_ |
PDB Entry: 1abr (more details), 2.14 Å
SCOP Domain Sequences for d1abrb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1abrb1 b.42.2.1 (B:1-140) Plant cytotoxin B-chain (lectin) {Abrus precatorius} ivekskicssryeptvriggrdgmcvdvydngyhngnriimwkckdrleenqlwtlksdk tirsngkclttygyapgsyvmiydctsavaeatyweiwdngtiinpksalvlsaesssmg gtltvqtneylmrqgwrtgn
Timeline for d1abrb1: