Lineage for d1abrb1 (1abr B:1-140)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 167295Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 167430Superfamily b.42.2: Ricin B-like lectins [50370] (2 families) (S)
  5. 167431Family b.42.2.1: Ricin B-like [50371] (2 proteins)
  6. 167432Protein Plant cytotoxin B-chain (lectin) [50372] (4 species)
  7. 167433Species Abrus precatorius [TaxId:3816] [50374] (1 PDB entry)
  8. 167434Domain d1abrb1: 1abr B:1-140 [25563]
    Other proteins in same PDB: d1abra_

Details for d1abrb1

PDB Entry: 1abr (more details), 2.14 Å

PDB Description: crystal structure of abrin-a

SCOP Domain Sequences for d1abrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1abrb1 b.42.2.1 (B:1-140) Plant cytotoxin B-chain (lectin) {Abrus precatorius}
ivekskicssryeptvriggrdgmcvdvydngyhngnriimwkckdrleenqlwtlksdk
tirsngkclttygyapgsyvmiydctsavaeatyweiwdngtiinpksalvlsaesssmg
gtltvqtneylmrqgwrtgn

SCOP Domain Coordinates for d1abrb1:

Click to download the PDB-style file with coordinates for d1abrb1.
(The format of our PDB-style files is described here.)

Timeline for d1abrb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1abrb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1abra_