SCOP 1.69: Domain d2aaib1: 2aai B:1-135

Lineage for d2aaib1 (2aai B:1-135)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (2 families)

5. Family b.42.2.1: Ricin B-like [50371] (6 proteins)

6. Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
   duplication: consists of two domains of this fold

7. Species Castor bean (Ricinus communis), Ricin [TaxId:3988] [50373] (1 PDB entry)

8. Domain d2aaib1: 2aai B:1-135 [25561]
   Other proteins in same PDB: d2aaia_

Details for d2aaib1

PDB Entry: 2aai, 2.5 Å

PDB Description: crystallographic refinement of ricin to 2.5 angstroms

SCOP Domain Sequences for d2aaib1:

Sequence; same for both SEQRES and ATOM records:

>d2aaib1 b.42.2.1 (B:1-135) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin}
advcmdpepivrivgrnglcvdvrdgrfhngnaiqlwpcksntdanqlwtlkrdntirsn
gkclttygyspgvyvmiydcntaatdatrwqiwdngtiinprsslvlaatsgnsgttltv
qtniyavsqgwlptn

Timeline for d2aaib1:

• d2aaib1 first appeared (with stable ids) in SCOP 1.55
  
• d2aaib1 appears in SCOP 1.67
  
• d2aaib1 appears in SCOP 1.71
  
• d2aaib1 appears in the current release, SCOPe 2.08