Lineage for d2ilaa_ (2ila A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061457Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2061458Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2061773Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 proteins)
  6. 2061798Protein Interleukin-1alpha [50368] (1 species)
  7. 2061799Species Human (Homo sapiens) [TaxId:9606] [50369] (1 PDB entry)
  8. 2061800Domain d2ilaa_: 2ila A: [25560]
    CA-atoms only

Details for d2ilaa_

PDB Entry: 2ila (more details), 2.3 Å

PDB Description: structure of interleukin 1alpha at 2.7-angstroms resolution
PDB Compounds: (A:) interleukin-1 alpha

SCOPe Domain Sequences for d2ilaa_:

Sequence, based on SEQRES records: (download)

>d2ilaa_ b.42.1.2 (A:) Interleukin-1alpha {Human (Homo sapiens) [TaxId: 9606]}
nvkynfmriikyefilndalnqsiiranaqyltaaalhnldeavkfdmgayksskddaki
tvilrisktqlyvtaqdedqpvllkempeipktitgsetnllffwethgtknyftsvahp
nlfiatkqdywvclaggppsitdfqile

Sequence, based on observed residues (ATOM records): (download)

>d2ilaa_ b.42.1.2 (A:) Interleukin-1alpha {Human (Homo sapiens) [TaxId: 9606]}
nvkynfmriikyefilndalnqsiiranaqyltaaalhnldeavkfdmgaykssakitvi
lrisktqlyvtaqdedqpvllkempeipktitgsetnllffwethgtknyftsvahpnlf
iatkqdywvclaggppsitdfqile

SCOPe Domain Coordinates for d2ilaa_:

Click to download the PDB-style file with coordinates for d2ilaa_.
(The format of our PDB-style files is described here.)

Timeline for d2ilaa_: